CYBA Antikörper (Middle Region)
-
- Target Alle CYBA Antikörper anzeigen
- CYBA (Cytochrome B-245, alpha Polypeptide (CYBA))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CYBA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CYBA antibody was raised against the middle region of CYBA
- Aufreinigung
- Affinity purified
- Immunogen
- CYBA antibody was raised using the middle region of CYBA corresponding to a region with amino acids TILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPP
- Top Product
- Discover our top product CYBA Primärantikörper
-
anti-Cytochrome B-245, alpha Polypeptide (CYBA) (AA 128-195) antibody
CYBA Reaktivität: Human ELISA, IF, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Cytochrome B-245, alpha Polypeptide (CYBA) (AA 21-120) antibodyCYBA Reaktivität: Human, Ratte, Maus WB, ELISA, IF (cc), IF (p), IHC (fro), IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Cytochrome B-245, alpha Polypeptide (CYBA) antibodyCYBA Reaktivität: Human IF, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Cytochrome B-245, alpha Polypeptide (CYBA) (AA 117-145), (C-Term) antibodyCYBA Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal RB31767 unconjugated
anti-Cytochrome B-245, alpha Polypeptide (CYBA) (N-Term) antibodyCYBA Reaktivität: Human, Ratte, Maus WB, ELISA, IF, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Cytochrome B-245, alpha Polypeptide (CYBA) antibodyCYBA Reaktivität: Human WB Wirt: Maus Monoclonal 44-1 unconjugated
anti-Cytochrome B-245, alpha Polypeptide (CYBA) antibodyCYBA Reaktivität: Human WB, ELISA, IF, IHC (fro), FACS, ICC, IP Wirt: Maus Monoclonal CS9 unconjugated
anti-Cytochrome B-245, alpha Polypeptide (CYBA) (AA 107-156) antibodyCYBA Reaktivität: Human, Ratte, Maus, Hund, Pferd, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Cytochrome B-245, alpha Polypeptide (CYBA) (Middle Region) antibodyCYBA Reaktivität: Human, Ratte, Maus, Schwein, Hund, Pferd, Rind (Kuh), Kaninchen, Schaf WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Cytochrome B-245, alpha Polypeptide (CYBA) (AA 124-153), (C-Term) antibodyCYBA Reaktivität: Human WB, IF, EIA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CYBA Blocking Peptide, catalog no. 33R-9120, is also available for use as a blocking control in assays to test for specificity of this CYBA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYBA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYBA (Cytochrome B-245, alpha Polypeptide (CYBA))
- Andere Bezeichnung
- CYBA (CYBA Produkte)
- Synonyme
- zgc:66077 antikoerper, MGC80750 antikoerper, CYBA antikoerper, p22-phox antikoerper, p22phox antikoerper, p22-PHOX antikoerper, b558 antikoerper, nmf333 antikoerper, P22-PHOX antikoerper, cytochrome b-245, alpha polypeptide antikoerper, cytochrome b-245 alpha polypeptide L homeolog antikoerper, cytochrome b-245 alpha polypeptide antikoerper, cytochrome b-245 light chain-like antikoerper, cytochrome b-245 alpha chain antikoerper, p22-phox antikoerper, cyba antikoerper, cyba.L antikoerper, CYBA antikoerper, LOC101328418 antikoerper, Cyba antikoerper
- Hintergrund
- Cytochrome b is comprised of a light chain (alpha) and a heavy chain (beta). This gene encodes the light, alpha subunit which has been proposed as a primary component of the microbicidal oxidase system of phagocytes.
- Molekulargewicht
- 21 kDa (MW of target protein)
- Pathways
- Regulation of Systemic Arterial Blood Pressure by Hormones, Carbohydrate Homeostasis
-
