SLC25A31 Antikörper

Produktnummer ABIN635043

Produktdetails anti-SLC25A31 Antikörper

Target: SLC25A31 (Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 31 (SLC25A31))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC25A31 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC25 A31 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYKGMVDCLVRIP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC25A31 Blocking Peptide, catalog no. 33R-4767, is also available for use as a blocking control in assays to test for specificity of this SLC25A31 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 31 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC25A31

Target: SLC25A31 (Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 31 (SLC25A31))

Andere Bezeichnung: SLC25A31 (SLC25A31 Produkte)

Synonyme: AAC4 antikoerper, ANT4 antikoerper, SFEC35kDa antikoerper, 1700034J06Rik antikoerper, Ant4 antikoerper, Sfec antikoerper, solute carrier family 25 member 31 antikoerper, solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 antikoerper, SLC25A31 antikoerper, Slc25a31 antikoerper

Hintergrund: Mitochondrial ADP/ATP carriers, such as SLC25A31, are nuclear-coded mitochondrial proteins that catalyze the exchange of ATP generated in mitochondria by ATP synthase against ADP produced in cytosol by most energy-consuming reactions.

Molekulargewicht: 35 kDa (MW of target protein)