VISTA Antikörper (V-type immunoglobulin domain-containing suppressor of T-cell activation) (N-Term)

Details for Product anti-VISTA Antibody No. ABIN635024
Antigen
  • MGC112715
  • MGC151567
  • B7-H5
  • B7H5
  • GI24
  • PP2135
  • SISP1
  • Dies1
  • VISTA
  • V-set immunoregulatory receptor
  • vsir
  • Vsir
  • VSIR
Epitop
N-Term
4
4
3
3
2
1
1
Reaktivität
Human
40
5
1
1
1
1
Wirt
Kaninchen
26
17
1
Klonalität
Polyklonal
Konjugat
Dieser VISTA Antikörper ist unkonjugiert
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
23
13
13
10
8
8
7
6
4
4
1
Optionen
Immunogen C10 ORF54 antibody was raised using the N terminal Of C10 rf54 corresponding to a region with amino acids TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLE
Spezifität C10 ORF54 antibody was raised against the N terminal Of C10 rf54
Reinigung Affinity purified
Antigen
Andere Bezeichnung C10ORF54 (VISTA Antibody Abstract)
Hintergrund C10ORF54 may be involved in protein binding and receptor activity.
Molekulargewicht 34 kDa (MW of target protein)
Pathways Cancer Immune Checkpoints
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

C10ORF54 Blocking Peptide, catalog no. 33R-9384, is also available for use as a blocking control in assays to test for specificity of this C10ORF54 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF54 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-V-type immunoglobulin domain-containing suppressor of T-cell activation (VISTA) (N-Term) antibody (ABIN635024) C10ORF54 antibody used at 1 ug/ml to detect target protein.
Haben Sie etwas anderes gesucht?