ORAI1 Antikörper (Middle Region)

Produktnummer ABIN634999

Produktdetails anti-ORAI1 Antikörper

Target: ORAI1 (ORAI Calcium Release-Activated Calcium Modulator 1 (ORAI1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ORAI1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ORAI1 antibody was raised against the middle region of ORAI1

Aufreinigung: Affinity purified

Immunogen: ORAI1 antibody was raised using the middle region of ORAI1 corresponding to a region with amino acids IGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ORAI1 Blocking Peptide, catalog no. 33R-3979, is also available for use as a blocking control in assays to test for specificity of this ORAI1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ORAI1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ORAI1

Target: ORAI1 (ORAI Calcium Release-Activated Calcium Modulator 1 (ORAI1))

Andere Bezeichnung: ORAI1 (ORAI1 Produkte)

Synonyme: CRACM1 antikoerper, ORAT1 antikoerper, TMEM142A antikoerper, RGD1311873 antikoerper, D730049H07Rik antikoerper, Tmem142a antikoerper, orai-1 antikoerper, im:7146264 antikoerper, orai1 antikoerper, tmem142a antikoerper, zgc:109721 antikoerper, orai2 antikoerper, ORAI1 antikoerper, LOC100218031 antikoerper, ORAI calcium release-activated calcium modulator 1 antikoerper, ORAI calcium release-activated calcium modulator 1b antikoerper, ORAI calcium release-activated calcium modulator 1 S homeolog antikoerper, ORAI1 antikoerper, Orai1 antikoerper, orai1b antikoerper, orai1.S antikoerper, orai1 antikoerper

Hintergrund: ORAI1 belongs to the Orai family. ORAI1 (CRACM1) is a plasma membrane protein essential for store-operated calcium entry. Defects in ORAI1 are a cause of severe combined immunodeficiency with CRAC channel dysfunction.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: T-Zell Rezeptor Signalweg, BCR Signaling