MOGAT2 Antikörper (Middle Region)

Produktnummer ABIN634991

Produktdetails anti-MOGAT2 Antikörper

Target: MOGAT2 (Monoacylglycerol O-Acyltransferase 2 (MOGAT2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MOGAT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MOGAT2 antibody was raised against the middle region of MOGAT2

Aufreinigung: Affinity purified

Immunogen: MOGAT2 antibody was raised using the middle region of MOGAT2 corresponding to a region with amino acids LLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGEN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MOGAT2 Blocking Peptide, catalog no. 33R-5142, is also available for use as a blocking control in assays to test for specificity of this MOGAT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOGAT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MOGAT2

Target: MOGAT2 (Monoacylglycerol O-Acyltransferase 2 (MOGAT2))

Andere Bezeichnung: MOGAT2 (MOGAT2 Produkte)

Synonyme: mogat2 antikoerper, DGAT2L5 antikoerper, MGAT2 antikoerper, Mgat1l antikoerper, wu:fb94h05 antikoerper, zgc:101667 antikoerper, dgat2l5 antikoerper, mgat2 antikoerper, mogat2-b antikoerper, monoacylglycerol O-acyltransferase 2, gene 1 antikoerper, monoacylglycerol O-acyltransferase 2 antikoerper, monoacylglycerol O-acyltransferase 2, gene 1 L homeolog antikoerper, mogat2.1 antikoerper, MOGAT2 antikoerper, Mogat2 antikoerper, mogat2 antikoerper, mogat2.1.L antikoerper

Hintergrund: Dietary fat absorption from the small intestine is facilitated by acyl-CoA:monoacylglycerol transferase (MOGAT) and acyl-CoA:diacylglycerol acyltransferase (DGAT) activities. MOGAT catalyzes the joining of monoacylglycerol and fatty acyl-CoAs to form diacylglycerol.

Molekulargewicht: 38 kDa (MW of target protein)