MOGAT2 Antikörper (Middle Region)
-
- Target Alle MOGAT2 Antikörper anzeigen
- MOGAT2 (Monoacylglycerol O-Acyltransferase 2 (MOGAT2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MOGAT2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MOGAT2 antibody was raised against the middle region of MOGAT2
- Aufreinigung
- Affinity purified
- Immunogen
- MOGAT2 antibody was raised using the middle region of MOGAT2 corresponding to a region with amino acids LLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGEN
- Top Product
- Discover our top product MOGAT2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MOGAT2 Blocking Peptide, catalog no. 33R-5142, is also available for use as a blocking control in assays to test for specificity of this MOGAT2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOGAT2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MOGAT2 (Monoacylglycerol O-Acyltransferase 2 (MOGAT2))
- Andere Bezeichnung
- MOGAT2 (MOGAT2 Produkte)
- Synonyme
- mogat2 antikoerper, DGAT2L5 antikoerper, MGAT2 antikoerper, Mgat1l antikoerper, wu:fb94h05 antikoerper, zgc:101667 antikoerper, dgat2l5 antikoerper, mgat2 antikoerper, mogat2-b antikoerper, monoacylglycerol O-acyltransferase 2, gene 1 antikoerper, monoacylglycerol O-acyltransferase 2 antikoerper, monoacylglycerol O-acyltransferase 2, gene 1 L homeolog antikoerper, mogat2.1 antikoerper, MOGAT2 antikoerper, Mogat2 antikoerper, mogat2 antikoerper, mogat2.1.L antikoerper
- Hintergrund
- Dietary fat absorption from the small intestine is facilitated by acyl-CoA:monoacylglycerol transferase (MOGAT) and acyl-CoA:diacylglycerol acyltransferase (DGAT) activities. MOGAT catalyzes the joining of monoacylglycerol and fatty acyl-CoAs to form diacylglycerol.
- Molekulargewicht
- 38 kDa (MW of target protein)
-