GIMAP5 Antikörper (Middle Region)

Produktnummer ABIN634956

Produktdetails anti-GIMAP5 Antikörper

Target: GIMAP5 (GTPase, IMAP Family Member 5 (GIMAP5))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GIMAP5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GIMAP5 antibody was raised against the middle region of GIMAP5

Aufreinigung: Affinity purified

Immunogen: GIMAP5 antibody was raised using the middle region of GIMAP5 corresponding to a region with amino acids CERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GIMAP5 Blocking Peptide, catalog no. 33R-1678, is also available for use as a blocking control in assays to test for specificity of this GIMAP5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GIMAP5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GIMAP5

Target: GIMAP5 (GTPase, IMAP Family Member 5 (GIMAP5))

Andere Bezeichnung: GIMAP5 (GIMAP5 Produkte)

Synonyme: HIMAP3 antikoerper, IAN-5 antikoerper, IAN4 antikoerper, IAN4L1 antikoerper, IAN5 antikoerper, IMAP3 antikoerper, IROD antikoerper, Ian4l1 antikoerper, Ian5 antikoerper, D630024P16 antikoerper, E230026N22Rik antikoerper, GTPase, IMAP family member 5 antikoerper, GTPase IMAP family member 5 antikoerper, GIMAP5 antikoerper, Gimap5 antikoerper, LOC463896 antikoerper

Hintergrund: GIMAP5 belongs to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response