SLC2A9 Antikörper (Solute Carrier Family 2 (Facilitated Glucose Transporter), Member 9)

Details for Product anti-SLC2A9 Antibody No. ABIN634903
Antigen
Reaktivität
Human
40
9
7
2
2
1
1
1
Wirt
Kaninchen
42
1
Klonalität
Polyklonal
Konjugat
Dieser SLC2A9 Antikörper ist unkonjugiert
3
3
2
2
2
2
Applikation
Western Blotting (WB)
40
23
4
2
1
1
1
Optionen
Immunogen GLUT9 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPPAKIPYVTLSTGGIETL
Reinigung Affinity purified
Antigen
Andere Bezeichnung GLUT9 (SLC2A9 Antibody Abstract)
Hintergrund SLC2A9 is a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. SLC2A9 may play a role in the development and survival of chondrocytes in cartilage matrices.
Molekulargewicht 56 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

GLUT9 Blocking Peptide, catalog no. 33R-9899, is also available for use as a blocking control in assays to test for specificity of this GLUT9 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 9 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Solute Carrier Family 2 (Facilitated Glucose Transporter), Member 9 (SLC2A9) antibody (ABIN634903) GLUT9 antibody used at 1 ug/ml to detect target protein.