ATP2B3 Antikörper (N-Term)

Produktnummer ABIN634900

Produktdetails anti-ATP2B3 Antikörper

Target: ATP2B3 (ATPase, Ca++ Transporting, Plasma Membrane 3 (ATP2B3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP2B3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ATP2 B3 antibody was raised against the N terminal of ATP2 3

Aufreinigung: Affinity purified

Immunogen: ATP2 B3 antibody was raised using the N terminal of ATP2 3 corresponding to a region with amino acids GDMANSSIEFHPKPQQQRDVPQAGGFGCTLAELRTLMELRGAEALQKIEE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATP2B3 Blocking Peptide, catalog no. 33R-3204, is also available for use as a blocking control in assays to test for specificity of this ATP2B3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATP2B3

Target: ATP2B3 (ATPase, Ca++ Transporting, Plasma Membrane 3 (ATP2B3))

Andere Bezeichnung: ATP2B3 (ATP2B3 Produkte)

Synonyme: PMCA3 antikoerper, PMCA3a antikoerper, SCAX1 antikoerper, atp2b3 antikoerper, pmca3a antikoerper, zgc:92885 antikoerper, 6430519O13Rik antikoerper, Pmca3 antikoerper, ATPase plasma membrane Ca2+ transporting 3 antikoerper, ATPase, Ca++ transporting, plasma membrane 3a antikoerper, ATPase, Ca++ transporting, plasma membrane 3 antikoerper, plasma membrane calcium-transporting ATPase 2 antikoerper, ATP2B3 antikoerper, atp2b3a antikoerper, Atp2b3 antikoerper, atp2b3 antikoerper, LOC100639471 antikoerper

Hintergrund: ATP2B3 gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis.

Molekulargewicht: 134 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process