SYNGR2 Antikörper (N-Term)
-
- Target Alle SYNGR2 Antikörper anzeigen
- SYNGR2 (Synaptogyrin 2 (SYNGR2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SYNGR2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Synaptogyrin 2 antibody was raised against the N terminal of SYNGR2
- Aufreinigung
- Affinity purified
- Immunogen
- Synaptogyrin 2 antibody was raised using the N terminal of SYNGR2 corresponding to a region with amino acids ESGAYGAAKAGGSFDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNA
- Top Product
- Discover our top product SYNGR2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Synaptogyrin 2 Blocking Peptide, catalog no. 33R-2727, is also available for use as a blocking control in assays to test for specificity of this Synaptogyrin 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYNGR2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SYNGR2 (Synaptogyrin 2 (SYNGR2))
- Andere Bezeichnung
- Synaptogyrin 2 (SYNGR2 Produkte)
- Synonyme
- Clast2 antikoerper, cellugyrin antikoerper, syngr2 antikoerper, MGC89604 antikoerper, Cellugyrin antikoerper, synaptogyrin 2 antikoerper, synaptogyrin 2 S homeolog antikoerper, SYNGR2 antikoerper, Syngr2 antikoerper, syngr2.S antikoerper, syngr2 antikoerper
- Hintergrund
- SYNGR2 is an integral membrane protein containing four transmembrane regions and a C-terminal cytoplasmic tail that is tyrosine phosphorylated. The exact function of this protein is unclear, but studies of a similar rat protein suggest that it may play a role in regulating membrane traffic in non-neuronal cells.
- Molekulargewicht
- 25 kDa (MW of target protein)
-