SLC36A2 Antikörper
-
- Target Alle SLC36A2 Antikörper anzeigen
- SLC36A2 (Solute Carrier Family 36 (Proton/amino Acid Symporter), Member 2 (SLC36A2))
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC36A2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC36 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLDESPSESAGLKKTKGITVFQALIHLVKGNMGTGILGLPLAVKNAGIL
- Top Product
- Discover our top product SLC36A2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC36A2 Blocking Peptide, catalog no. 33R-9067, is also available for use as a blocking control in assays to test for specificity of this SLC36A2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC36A2 (Solute Carrier Family 36 (Proton/amino Acid Symporter), Member 2 (SLC36A2))
- Andere Bezeichnung
- SLC36A2 (SLC36A2 Produkte)
- Synonyme
- DKFZp469P1320 antikoerper, PAT2 antikoerper, TRAMD1 antikoerper, A530067G19Rik antikoerper, Tramd1 antikoerper, Pat2 antikoerper, solute carrier family 36 member 2 antikoerper, solute carrier family 36 (proton/amino acid symporter), member 2 antikoerper, SLC36A2 antikoerper, Slc36a2 antikoerper
- Hintergrund
- SLC36A2 is involved in a pH-dependent electrogenic neuronal transport and sequestration of small amino acids amino acids such as glycine, alanine and proline. SLC36A2 is inhibited by sarcosine.
- Molekulargewicht
- 53 kDa (MW of target protein)
- Pathways
- Proton Transport
-