GPR75 Antikörper (Middle Region)
-
- Target Alle GPR75 Antikörper anzeigen
- GPR75 (G Protein-Coupled Receptor 75 (GPR75))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GPR75 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GPR75 antibody was raised against the middle region of GPR75
- Aufreinigung
- Affinity purified
- Immunogen
- GPR75 antibody was raised using the middle region of GPR75 corresponding to a region with amino acids PSQEESSPCNLQPVNSFGFANSYIAMHYHTTNDLVQEYDSTSAKQIPVPS
- Top Product
- Discover our top product GPR75 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GPR75 Blocking Peptide, catalog no. 33R-7365, is also available for use as a blocking control in assays to test for specificity of this GPR75 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR75 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GPR75 (G Protein-Coupled Receptor 75 (GPR75))
- Andere Bezeichnung
- GPR75 (GPR75 Produkte)
- Synonyme
- GPR75 antikoerper, GPRchr2 antikoerper, WI31133 antikoerper, G protein-coupled receptor 75 antikoerper, G protein-coupled receptor 75 S homeolog antikoerper, GPR75 antikoerper, gpr75 antikoerper, Gpr75 antikoerper, gpr75.S antikoerper
- Hintergrund
- GPR75 is an orphan receptor.GPR75 is a member of the G protein-coupled receptor family. GPRs are cell surface receptors that activate guanine-nucleotide binding proteins upon the binding of a ligand.
- Molekulargewicht
- 59 kDa (MW of target protein)
-