SEC22C Antikörper
-
- Target Alle SEC22C Antikörper anzeigen
- SEC22C (SEC22 Vesicle Trafficking Protein Homolog C (SEC22C))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SEC22C Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SEC22 C antibody was raised using a synthetic peptide corresponding to a region with amino acids FRMEPVTALGILSLILNIMCAALNLIRGVHLAEHSLQVAHEEIGNILAFL
- Top Product
- Discover our top product SEC22C Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SEC22C Blocking Peptide, catalog no. 33R-3053, is also available for use as a blocking control in assays to test for specificity of this SEC22C antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEC20 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SEC22C (SEC22 Vesicle Trafficking Protein Homolog C (SEC22C))
- Andere Bezeichnung
- SEC22C (SEC22C Produkte)
- Synonyme
- 4932412K21 antikoerper, 5930407I15Rik antikoerper, C530046H07 antikoerper, Sec22l3 antikoerper, SEC22L3 antikoerper, SEC22 homolog C, vesicle trafficking protein antikoerper, Sec22c antikoerper, SEC22C antikoerper
- Hintergrund
- The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It is localized at the endoplasmic reticulum and it is thought to play a role in the early stages of the ER-Golgi protein trafficking.
- Molekulargewicht
- 34 kDa (MW of target protein)
-