SLC22A14 Antikörper (N-Term)

Produktnummer ABIN634865

Produktdetails anti-SLC22A14 Antikörper

Target: SLC22A14 (Solute Carrier Family 22 (Organic Cation Transporter), Member 14 (SLC22A14))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC22A14 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC22 A14 antibody was raised against the N terminal of SLC22 14

Aufreinigung: Affinity purified

Immunogen: SLC22 A14 antibody was raised using the N terminal of SLC22 14 corresponding to a region with amino acids IIQFGLNDTDTCQDGWIYPDAKKRSLINEFDLVCGMETKKDTAQIMFMAG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC22A14 Blocking Peptide, catalog no. 33R-4005, is also available for use as a blocking control in assays to test for specificity of this SLC22A14 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 14 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC22A14

Target: SLC22A14 (Solute Carrier Family 22 (Organic Cation Transporter), Member 14 (SLC22A14))

Andere Bezeichnung: SLC22A14 (SLC22A14 Produkte)

Synonyme: Gm1128 antikoerper, OCTL2 antikoerper, OCTL4 antikoerper, ORCTL4 antikoerper, solute carrier family 22, member 14 antikoerper, solute carrier family 22 member 14 antikoerper, solute carrier family 22 (organic cation transporter), member 14 antikoerper, Slc22a14 antikoerper, SLC22A14 antikoerper

Hintergrund: SLC22A14 is a member of the organic-cation transporter family. SLC22A14 is a transmembrane protein which is thought to transport small molecules and since this protein is conserved among several species, it is suggested to have a fundamental role in mammalian systems.

Molekulargewicht: 67 kDa (MW of target protein)