Presenilin 1 Antikörper (N-Term)
-
- Target Alle Presenilin 1 (PSEN1) Antikörper anzeigen
- Presenilin 1 (PSEN1)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Presenilin 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Presenilin 1 antibody was raised against the N terminal of PSEN1
- Aufreinigung
- Affinity purified
- Immunogen
- Presenilin 1 antibody was raised using the N terminal of PSEN1 corresponding to a region with amino acids TRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKY
- Top Product
- Discover our top product PSEN1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Presenilin 1 Blocking Peptide, catalog no. 33R-9260, is also available for use as a blocking control in assays to test for specificity of this Presenilin 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSEN1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Presenilin 1 (PSEN1)
- Andere Bezeichnung
- Presenilin 1 (PSEN1 Produkte)
- Synonyme
- pre1 antikoerper, psen antikoerper, zfPS1 antikoerper, zf-PS1 antikoerper, ad3 antikoerper, fad antikoerper, ps1 antikoerper, s182 antikoerper, X-PS-beta antikoerper, X-PS-alpha antikoerper, AD3 antikoerper, FAD antikoerper, PS-1 antikoerper, PS1 antikoerper, S182 antikoerper, Ad3h antikoerper, presenilin 1 antikoerper, presenilin 1 L homeolog antikoerper, psen1 antikoerper, PSEN1 antikoerper, Psen1 antikoerper, psen1.L antikoerper
- Hintergrund
- Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1, PSEN2) or in the amyloid precursor protein (APP).
- Molekulargewicht
- 53 kDa (MW of target protein)
- Pathways
- Notch Signalweg, EGFR Signaling Pathway, Synaptic Vesicle Exocytosis, Dicarboxylic Acid Transport
-