LCLAT1 Antikörper (Middle Region)

Produktnummer ABIN634820

Produktdetails anti-LCLAT1 Antikörper

Target: LCLAT1 (Lysocardiolipin Acyltransferase 1 (LCLAT1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LCLAT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LYCAT antibody was raised against the middle region of LYCAT

Aufreinigung: Affinity purified

Immunogen: LYCAT antibody was raised using the middle region of LYCAT corresponding to a region with amino acids YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LYCAT Blocking Peptide, catalog no. 33R-10186, is also available for use as a blocking control in assays to test for specificity of this LYCAT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYCAT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LCLAT1

Target: LCLAT1 (Lysocardiolipin Acyltransferase 1 (LCLAT1))

Andere Bezeichnung: LYCAT (LCLAT1 Produkte)

Synonyme: lclat1 antikoerper, zgc:77380 antikoerper, wu:fj17g04 antikoerper, LYCAT antikoerper, lycat antikoerper, agpat8 antikoerper, alcat1 antikoerper, 1agpat8 antikoerper, AGPATP8 antikoerper, 1AGPAT8 antikoerper, AGPAT8 antikoerper, ALCAT1 antikoerper, HSRG1849 antikoerper, UNQ1849 antikoerper, AI181996 antikoerper, Agpat8 antikoerper, Alcat1 antikoerper, Gm91 antikoerper, Lycat antikoerper, RGD1565906 antikoerper, lysocardiolipin acyltransferase 1 antikoerper, lclat1 antikoerper, LCLAT1 antikoerper, Lclat1 antikoerper

Hintergrund: LYCAT is an acyl-CoA:lysocardiolipin acyltransferase. It possesses both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities. LYCAT recognises both monolysocardiolipin and dilysocardiolipin as substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. LYCAT acts as a remodeling enzyme for cardiolipin, a major membrane polyglycerophospholipid. It converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) with a relatively low activity. LYCAT is required for establishment of the hematopoietic and endothelial lineages.

Molekulargewicht: 44 kDa (MW of target protein)