Growth Hormone 2 Antikörper (Middle Region)
-
- Target Alle Growth Hormone 2 (GH2) Antikörper anzeigen
- Growth Hormone 2 (GH2)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Growth Hormone 2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Growth Hormone 2 antibody was raised against the middle region of GH2
- Aufreinigung
- Affinity purified
- Immunogen
- Growth Hormone 2 antibody was raised using the middle region of GH2 corresponding to a region with amino acids LEEGIQTLIGWKMAAPGLGRSSISPTASLTQNRTTMTHCSRTTGCSTASG
- Top Product
- Discover our top product GH2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Growth Hormone 2 Blocking Peptide, catalog no. 33R-4888, is also available for use as a blocking control in assays to test for specificity of this Growth Hormone 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GH2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Growth Hormone 2 (GH2)
- Andere Bezeichnung
- Growth Hormone 2 (GH2 Produkte)
- Synonyme
- GH-V antikoerper, GHL antikoerper, GHV antikoerper, hGH-V antikoerper, growth hormone 2 antikoerper, GH2 antikoerper
- Substanzklasse
- Hormone
- Hintergrund
- GH2 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. Mutations in its gene lead to placental growth hormone/lactogen deficiency.
- Molekulargewicht
- 27 kDa (MW of target protein)
- Pathways
- NF-kappaB Signalweg, JAK-STAT Signalweg, Response to Growth Hormone Stimulus
-