COPA Antikörper (Middle Region)

Produktnummer ABIN634778

Produktdetails anti-COPA Antikörper

Target: COPA (Coatomer Protein Complex, Subunit alpha (COPA))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser COPA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: COPA antibody was raised against the middle region of COPA

Aufreinigung: Affinity purified

Immunogen: COPA antibody was raised using the middle region of COPA corresponding to a region with amino acids IPKDADSQNPDAPEGKRSSGLTAVWVARNRFAVLDRMHSLLIKNLKNEIT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

COPA Blocking Peptide, catalog no. 33R-4092, is also available for use as a blocking control in assays to test for specificity of this COPA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COPA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu COPA

Target: COPA (Coatomer Protein Complex, Subunit alpha (COPA))

Andere Bezeichnung: COPA (COPA Produkte)

Synonyme: COPA antikoerper, DDBDRAFT_0189693 antikoerper, DDBDRAFT_0233797 antikoerper, DDB_0189693 antikoerper, DDB_0233797 antikoerper, DKFZp469O221 antikoerper, AU040324 antikoerper, xenin antikoerper, HEP-COP antikoerper, cb281 antikoerper, fb13c12 antikoerper, wu:fb13c12 antikoerper, coatomer protein complex subunit alpha antikoerper, WD40 repeat-containing protein antikoerper, Coatomer subunit alpha antikoerper, coatomer protein complex, subunit alpha antikoerper, coatomer protein complex subunit alpha L homeolog antikoerper, COPA antikoerper, copA antikoerper, cgd8_860 antikoerper, Chro.80105 antikoerper, AFUA_3G08840 antikoerper, copa antikoerper, Copa antikoerper, copa.L antikoerper

Hintergrund: In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). The alpha-COP, encoded by COPA, shares high sequence similarity with RET1P, the alpha subunit of the coatomer complex in yeast. Also, the N-terminal 25 amino acids of alpha-COP encode the bioactive peptide, xenin, which stimulates exocrine pancreatic secretion and may act as a gastrointestinal hormone.

Molekulargewicht: 135 kDa (MW of target protein)

Pathways: Hormone Activity