Cadherin 4 Antikörper

Produktnummer ABIN634764

Der Kaninchen Polyklonal anti-Cadherin 4 Antikörper (ABIN634764) detektiert spezifisch Cadherin 4 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für Cadherin 4 Antikörper (ABIN634764)

Target: Cadherin 4 (CDH4)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cadherin 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Cadherin 4 Antikörper

Aufreinigung: Affinity purified

Immunogen: CDH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids RIISGDPSGHFSVRTDPVTNEGMVTVVKAVDYELNRAFMLTVMVSNQAPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDH4 Blocking Peptide, (ABIN5612783), is also available for use as a blocking control in assays to test for specificity of this CDH4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cadherin 4

Target: Cadherin 4 (CDH4)

Andere Bezeichnung: CDH4

Hintergrund: CDH4 gene is a classical cadherin from the cadherin superfamily. The protein is a calcium-dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Based on studies in chicken and mouse, this cadherin is thought to play an important role during brain segmentation and neuronal outgrowth. In addition, a role in kidney and muscle development is indicated. Of particular interest are studies showing stable cis-heterodimers of cadherins 2 and 4 in cotransfected cell lines. Previously thought to interact in an exclusively homophilic manner, this is the first evidence of cadherin heterodimerization.

Molekulargewicht: 82 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Regulation of Cell Size