Claudin 15 Antikörper (Middle Region)

Produktnummer ABIN634748

Produktdetails anti-Claudin 15 Antikörper

Target: Claudin 15 (CLDN15)

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Claudin 15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Claudin 15 antibody was raised against the middle region of CLDN15

Aufreinigung: Affinity purified

Immunogen: Claudin 15 antibody was raised using the middle region of CLDN15 corresponding to a region with amino acids LSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Claudin 15 Blocking Peptide, catalog no. 33R-5429, is also available for use as a blocking control in assays to test for specificity of this Claudin 15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Claudin 15

Target: Claudin 15 (CLDN15)

Andere Bezeichnung: Claudin 15 (CLDN15 Produkte)

Synonyme: CLDN15 antikoerper, cldn15 antikoerper, cldn15l antikoerper, zgc:63943 antikoerper, zgc:136755 antikoerper, 2210009B08Rik antikoerper, BB107105 antikoerper, claudin 15 antikoerper, claudin 15a antikoerper, claudin 15b antikoerper, Cldn15 antikoerper, CLDN15 antikoerper, cldn15a antikoerper, cldn15b antikoerper

Hintergrund: CLDN15 plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.

Molekulargewicht: 24 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C