GJC2 Antikörper (Middle Region)

Produktnummer ABIN634743

Produktdetails anti-GJC2 Antikörper

Target: GJC2 (Gap Junction Protein, gamma 2, 47kDa (GJC2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GJC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GJC2 antibody was raised against the middle region of GJC2

Aufreinigung: Affinity purified

Immunogen: GJC2 antibody was raised using the middle region of GJC2 corresponding to a region with amino acids APASRTGSATSAGTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GJC2 Blocking Peptide, catalog no. 33R-1416, is also available for use as a blocking control in assays to test for specificity of this GJC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GJC2

Target: GJC2 (Gap Junction Protein, gamma 2, 47kDa (GJC2))

Andere Bezeichnung: GJC2 (GJC2 Produkte)

Synonyme: GJA12 antikoerper, cx47 antikoerper, gja12 antikoerper, cx46.6 antikoerper, pmldar antikoerper, MGC146420 antikoerper, B230382L12Rik antikoerper, Cx47 antikoerper, Gja12 antikoerper, CX46.6 antikoerper, HLD2 antikoerper, LMPH1C antikoerper, PMLDAR antikoerper, SPG44 antikoerper, gap junction protein gamma 2 antikoerper, si:dkey-91f15.1 antikoerper, gap junction protein, gamma 2 antikoerper, GJC2 antikoerper, gjc2 antikoerper, si:dkey-91f15.1 antikoerper, Gjc2 antikoerper

Hintergrund: GJC2 is a gap junction protein. Gap junction proteins are members of a large family of homologous connexins and comprise 4 transmembrane, 2 extracellular, and 3 cytoplasmic domains. This gene plays a key role in central myelination and is involved in peripheral myelination in humans.

Molekulargewicht: 47 kDa (MW of target protein)