Neuroligin 4 Antikörper (N-Term)
-
- Target Alle Neuroligin 4 (NLGN4) Antikörper anzeigen
- Neuroligin 4 (NLGN4)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Neuroligin 4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NLGN4 X antibody was raised against the N terminal of NLGN4
- Aufreinigung
- Affinity purified
- Immunogen
- NLGN4 X antibody was raised using the N terminal of NLGN4 corresponding to a region with amino acids SILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEEN
- Top Product
- Discover our top product NLGN4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NLGN4X Blocking Peptide, catalog no. 33R-8532, is also available for use as a blocking control in assays to test for specificity of this NLGN4X antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NLGN0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Neuroligin 4 (NLGN4)
- Andere Bezeichnung
- NLGN4X (NLGN4 Produkte)
- Synonyme
- ASPGX2 antikoerper, AUTSX2 antikoerper, HLNX antikoerper, HNL4X antikoerper, NLGN4 antikoerper, nlgn4 antikoerper, NLGN4X antikoerper, Nlgn4x antikoerper, neuroligin 4, X-linked antikoerper, neuroligin-4, X-linked antikoerper, NLGN4X antikoerper, nlgn4x antikoerper, LOC100714631 antikoerper
- Hintergrund
- NLGN4X is a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. It interacts with discs, large (Drosophila) homolog 4 (DLG4). NLGN4X might play a role in the autism and Asperger syndrome.
- Molekulargewicht
- 92 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization, Synaptic Membrane
-