Acetylcholinesterase Antikörper
-
- Target Alle Acetylcholinesterase (AChE) Antikörper anzeigen
- Acetylcholinesterase (AChE)
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Acetylcholinesterase Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- AChE antibody was raised using a synthetic peptide corresponding to a region with amino acids VGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEA
- Top Product
- Discover our top product AChE Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AChE Blocking Peptide, catalog no. 33R-9575, is also available for use as a blocking control in assays to test for specificity of this AChE antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACHE antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Acetylcholinesterase (AChE)
- Andere Bezeichnung
- AChE (AChE Produkte)
- Synonyme
- ACEE antikoerper, ARACHE antikoerper, N-ACHE antikoerper, YT antikoerper, Ache antikoerper, GB14873 antikoerper, zgc:92550 antikoerper, ACE antikoerper, Dsim\\GD20515 antikoerper, GD20515 antikoerper, dsim_GLEANR_4292 antikoerper, ache antikoerper, mE1a antikoerper, mE1b antikoerper, mE1c antikoerper, mE1c-long antikoerper, mE1d antikoerper, mE1d' antikoerper, mE1e antikoerper, arache antikoerper, n-ache antikoerper, acetylcholinesterase (Cartwright blood group) antikoerper, acetylcholinesterase 2 antikoerper, acetylcholinesterase antikoerper, Acetylcholine esterase antikoerper, acetylcholinesterase (Cartwright blood group) L homeolog antikoerper, collagen type I alpha 2 chain antikoerper, ACHE antikoerper, AChE-2 antikoerper, Ache antikoerper, ache antikoerper, Dsim\Ace antikoerper, ache.L antikoerper, COL1A2 antikoerper, ACE-1 antikoerper
- Hintergrund
- Acetylcholinesterase hydrolyzes the neurotransmitter, acetylcholine at neuromuscular junctions and brain cholinergic synapses, and thus terminates signal transmission. It is also found on the red blood cell membranes.
- Molekulargewicht
- 68 kDa (MW of target protein)
- Pathways
- Skeletal Muscle Fiber Development
-