IGFALS Antikörper (Middle Region)

Produktnummer ABIN634645

Produktdetails anti-IGFALS Antikörper

Target: IGFALS (Insulin-Like Growth Factor Binding Protein, Acid Labile Subunit (IGFALS))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IGFALS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IGFALS antibody was raised against the middle region of IGFALS

Aufreinigung: Affinity purified

Immunogen: IGFALS antibody was raised using the middle region of IGFALS corresponding to a region with amino acids DCGCPLKALRDFALQNPSAVPRFVQAICEGDDCQPPAYTYNNITCASPPE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IGFALS Blocking Peptide, catalog no. 33R-1869, is also available for use as a blocking control in assays to test for specificity of this IGFALS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGFALS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IGFALS

Target: IGFALS (Insulin-Like Growth Factor Binding Protein, Acid Labile Subunit (IGFALS))

Andere Bezeichnung: IGFALS (IGFALS Produkte)

Synonyme: ALS antikoerper, Albs antikoerper, mKIAA4111 antikoerper, Als antikoerper, insulin like growth factor binding protein acid labile subunit antikoerper, insulin like growth factor binding protein acid labile subunit L homeolog antikoerper, insulin-like growth factor binding protein, acid labile subunit antikoerper, IGFALS antikoerper, igfals.L antikoerper, Igfals antikoerper

Hintergrund: The protein encoded by this gene is a serum protein that binds insulin-like growth factors, increasing their half-life and their vascular localization. Production of the encoded protein, which contains twenty leucine-rich repeats, is stimulated by growth hormone. Three transcript variants encoding two different isoforms have been found for this gene.

Molekulargewicht: 63 kDa (MW of target protein)