IGFALS Antikörper (Middle Region)
-
- Target Alle IGFALS Antikörper anzeigen
- IGFALS (Insulin-Like Growth Factor Binding Protein, Acid Labile Subunit (IGFALS))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IGFALS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IGFALS antibody was raised against the middle region of IGFALS
- Aufreinigung
- Affinity purified
- Immunogen
- IGFALS antibody was raised using the middle region of IGFALS corresponding to a region with amino acids DCGCPLKALRDFALQNPSAVPRFVQAICEGDDCQPPAYTYNNITCASPPE
- Top Product
- Discover our top product IGFALS Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IGFALS Blocking Peptide, catalog no. 33R-1869, is also available for use as a blocking control in assays to test for specificity of this IGFALS antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGFALS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IGFALS (Insulin-Like Growth Factor Binding Protein, Acid Labile Subunit (IGFALS))
- Andere Bezeichnung
- IGFALS (IGFALS Produkte)
- Synonyme
- ALS antikoerper, Albs antikoerper, mKIAA4111 antikoerper, Als antikoerper, insulin like growth factor binding protein acid labile subunit antikoerper, insulin like growth factor binding protein acid labile subunit L homeolog antikoerper, insulin-like growth factor binding protein, acid labile subunit antikoerper, IGFALS antikoerper, igfals.L antikoerper, Igfals antikoerper
- Hintergrund
- The protein encoded by this gene is a serum protein that binds insulin-like growth factors, increasing their half-life and their vascular localization. Production of the encoded protein, which contains twenty leucine-rich repeats, is stimulated by growth hormone. Three transcript variants encoding two different isoforms have been found for this gene.
- Molekulargewicht
- 63 kDa (MW of target protein)
-