HABP2 Antikörper (Middle Region)
-
- Target Alle HABP2 Antikörper anzeigen
- HABP2 (Hyaluronan Binding Protein 2 (HABP2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HABP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HABP2 antibody was raised against the middle region of HABP2
- Aufreinigung
- Affinity purified
- Immunogen
- HABP2 antibody was raised using the middle region of HABP2 corresponding to a region with amino acids EPSTKLPGFDSCGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTI
- Top Product
- Discover our top product HABP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HABP2 Blocking Peptide, catalog no. 33R-2649, is also available for use as a blocking control in assays to test for specificity of this HABP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HABP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HABP2 (Hyaluronan Binding Protein 2 (HABP2))
- Andere Bezeichnung
- HABP2 (HABP2 Produkte)
- Synonyme
- HABP2 antikoerper, habp2 antikoerper, FSAP antikoerper, HABP antikoerper, HGFAL antikoerper, PHBP antikoerper, Fsap antikoerper, Habp antikoerper, Phbp antikoerper, AI035669 antikoerper, hyaluronan binding protein 2 antikoerper, hyaluronic acid binding protein 2 antikoerper, HABP2 antikoerper, habp2 antikoerper, Habp2 antikoerper
- Hintergrund
- HABP2 is an extracellular serine protease that binds hyaluronic acid and is involved in cell adhesion. It is synthesized as a single chain, but then undergoes an autoproteolytic event to form the functional heterodimer. Further autoproteolysis leads to smaller, inactive peptides. This protease is known to cleave urinary plasminogen activator, coagulation factor VII, and the alpha and beta chains of fibrinogen, but not prothrombin, plasminogen, or the gamma chain of fibrinogen.
- Molekulargewicht
- 63 kDa (MW of target protein)
-