ADAM12 Antikörper

Produktnummer ABIN634632

Der Kaninchen Polyklonal anti-ADAM12 Antikörper (ABIN634632) detektiert spezifisch ADAM12 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für ADAM12 Antikörper (ABIN634632)

Target: ADAM12 (ADAM Metallopeptidase Domain 12 (ADAM12))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADAM12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ADAM12 Antikörper

Aufreinigung: Affinity purified

Immunogen: ADAM12 antibody was raised using a synthetic peptide corresponding to a region with amino acids VELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADAM12 Blocking Peptide, (ABIN5611931), is also available for use as a blocking control in assays to test for specificity of this ADAM12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADAM12

Target: ADAM12 (ADAM Metallopeptidase Domain 12 (ADAM12))

Andere Bezeichnung: ADAM12

Hintergrund: ADAM12 is a member of the ADAM (a disintegrin and metalloprotease) protein family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis.

Molekulargewicht: 58 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway