SLIT3 Antikörper
-
- Target Alle SLIT3 Antikörper anzeigen
- SLIT3 (Slit Homolog 3 (SLIT3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLIT3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLIT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV
- Top Product
- Discover our top product SLIT3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLIT3 Blocking Peptide, catalog no. 33R-7343, is also available for use as a blocking control in assays to test for specificity of this SLIT3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLIT3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLIT3 (Slit Homolog 3 (SLIT3))
- Andere Bezeichnung
- SLIT3 (SLIT3 Produkte)
- Synonyme
- MGC146100 antikoerper, zgc:111911 antikoerper, MEGF5 antikoerper, SLIL2 antikoerper, SLIT1 antikoerper, Slit-3 antikoerper, slit2 antikoerper, Slil2 antikoerper, Slit1 antikoerper, Megf5 antikoerper, slit guidance ligand 3 antikoerper, slit homolog 3 (Drosophila) antikoerper, Slit3 antikoerper, slit3 antikoerper, SLIT3 antikoerper, LOC100125612 antikoerper, Slit3 antikoerper
- Hintergrund
- SLIT3 may act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors.
- Molekulargewicht
- 168 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-