PHLDA2 Antikörper (Middle Region)

Produktnummer ABIN634590

Produktdetails anti-PHLDA2 Antikörper

Target: PHLDA2 (Pleckstrin Homology-Like Domain, Family A, Member 2 (PHLDA2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PHLDA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PHLDA2 antibody was raised against the middle region of PHLDA2

Aufreinigung: Affinity purified

Immunogen: PHLDA2 antibody was raised using the middle region of PHLDA2 corresponding to a region with amino acids QNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PHLDA2 Blocking Peptide, catalog no. 33R-7668, is also available for use as a blocking control in assays to test for specificity of this PHLDA2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHLDA2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PHLDA2

Target: PHLDA2 (Pleckstrin Homology-Like Domain, Family A, Member 2 (PHLDA2))

Andere Bezeichnung: PHLDA2 (PHLDA2 Produkte)

Synonyme: PHLDA2 antikoerper, ipl antikoerper, phlda2 antikoerper, BRW1C antikoerper, BWR1C antikoerper, HLDA2 antikoerper, IPL antikoerper, TSSC3 antikoerper, Ipl antikoerper, Tssc3 antikoerper, zgc:110459 antikoerper, pleckstrin homology like domain family A member 2 antikoerper, Pleckstrin homology-like domain family A member 2 antikoerper, pleckstrin homology like domain, family A, member 2 antikoerper, pleckstrin homology-like domain, family A, member 2 antikoerper, pleckstrin homology-like domain, family A, member 2 L homeolog antikoerper, PHLDA2 antikoerper, phla2 antikoerper, Phlda2 antikoerper, phlda2.L antikoerper, phlda2 antikoerper

Hintergrund: This gene is one of several genes in the imprinted gene domain of 11p15.5 which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor and rhabdomyosarcoma.

Molekulargewicht: 17 kDa (MW of target protein)

Pathways: Regulation of Carbohydrate Metabolic Process