HLA-DPA1 Antikörper (Middle Region)
-
- Target Alle HLA-DPA1 Antikörper anzeigen
- HLA-DPA1 (Major Histocompatibility Complex, Class II, DP alpha 1 (HLA-DPA1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HLA-DPA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HLA-DPA1 antibody was raised against the middle region of HLA-DPA1
- Aufreinigung
- Affinity purified
- Immunogen
- HLA-DPA1 antibody was raised using the middle region of HLA-DPA1 corresponding to a region with amino acids EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT
- Top Product
- Discover our top product HLA-DPA1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HLA-DPA1 Blocking Peptide, catalog no. 33R-2275, is also available for use as a blocking control in assays to test for specificity of this HLA-DPA1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HLA-DPA1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HLA-DPA1 (Major Histocompatibility Complex, Class II, DP alpha 1 (HLA-DPA1))
- Andere Bezeichnung
- HLA-DPA1 (HLA-DPA1 Produkte)
- Synonyme
- DP(W3) antikoerper, DP(W4) antikoerper, HLA-DP1A antikoerper, HLADP antikoerper, HLASB antikoerper, PLT1 antikoerper, major histocompatibility complex, class II, DP alpha 1 antikoerper, HLA-DPA1 antikoerper
- Hintergrund
- HLA-DPA1 belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta (DPB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins.
- Molekulargewicht
- 26 kDa (MW of target protein)
- Pathways
- T-Zell Rezeptor Signalweg, Cancer Immune Checkpoints
-