KLRF1 Antikörper (Middle Region)
-
- Target Alle KLRF1 Antikörper anzeigen
- KLRF1 (Killer Cell Lectin-Like Receptor Subfamily F, Member 1 (KLRF1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KLRF1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KLRF1 antibody was raised against the middle region of KLRF1
- Aufreinigung
- Affinity purified
- Immunogen
- KLRF1 antibody was raised using the middle region of KLRF1 corresponding to a region with amino acids QKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLK
- Top Product
- Discover our top product KLRF1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KLRF1 Blocking Peptide, catalog no. 33R-7602, is also available for use as a blocking control in assays to test for specificity of this KLRF1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLRF1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KLRF1 (Killer Cell Lectin-Like Receptor Subfamily F, Member 1 (KLRF1))
- Andere Bezeichnung
- KLRF1 (KLRF1 Produkte)
- Synonyme
- CLEC5C antikoerper, NKp80 antikoerper, KLRF1 antikoerper, Lectin-like receptor F1 antikoerper, nkp80 antikoerper, killer cell lectin like receptor F1 antikoerper, KLRF1 antikoerper
- Hintergrund
- KLRF1, an activating homodimeric C-type lectin-like receptor (CTLR), is expressed on nearly all natural killer (NK) cells and stimulates their cytoxicity and cytokine release.
- Molekulargewicht
- 26 kDa (MW of target protein)
-