KLRA1 Antikörper (N-Term)
-
- Target Alle KLRA1 Antikörper anzeigen
- KLRA1 (Killer Cell Lectin-Like Receptor, Subfamily A, Member 1 (KLRA1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KLRA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KLRA1 antibody was raised against the N terminal of KLRA1
- Aufreinigung
- Affinity purified
- Immunogen
- KLRA1 antibody was raised using the N terminal of KLRA1 corresponding to a region with amino acids NDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWHLIAVTL
- Top Product
- Discover our top product KLRA1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KLRA1 Blocking Peptide, catalog no. 33R-6660, is also available for use as a blocking control in assays to test for specificity of this KLRA1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLRA1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KLRA1 (Killer Cell Lectin-Like Receptor, Subfamily A, Member 1 (KLRA1))
- Andere Bezeichnung
- KLRA1 (KLRA1 Produkte)
- Synonyme
- Klra2 antikoerper, Ly49i8 antikoerper, A1 antikoerper, Klra22 antikoerper, Ly49a antikoerper, Ly49o<129> antikoerper, Ly49v antikoerper, LY49 antikoerper, KLRA1 antikoerper, Ly49 antikoerper, killer cell lectin-like receptor, subfamily A, member 1 antikoerper, killer cell lectin-like receptor subfamily A, member 1 antikoerper, Klra1 antikoerper, KLRA1 antikoerper, LY49 antikoerper
- Hintergrund
- Ly-49 Receptors or killer cell lectin-like receptor subfamily A (KLRA), member 1, are a class of natural killer cell receptor. Ly-49 proteins are a diverse set of C-type lectins that are expressed on NK cells in some mammals, including rodents but not humans. Their primary function is to bind host MHC class I as a mechanism of self/health recognition. Upon binding ligands, most Ly-49 receptors will deliver an inhibitory signal, preventing killing of the target cell.
- Molekulargewicht
- 25 kDa (MW of target protein)
-