Perforin 1 Antikörper

Produktnummer ABIN634500

Produktdetails anti-Perforin 1 Antikörper

Target: Perforin 1 (PRF1) (Perforin 1 (Pore Forming Protein) (PRF1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Perforin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Perforin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Perforin 1 Blocking Peptide, catalog no. 33R-8899, is also available for use as a blocking control in assays to test for specificity of this Perforin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Perforin 1

Target: Perforin 1 (PRF1) (Perforin 1 (Pore Forming Protein) (PRF1))

Andere Bezeichnung: Perforin 1 (PRF1 Produkte)

Synonyme: FLH2 antikoerper, HPLH2 antikoerper, P1 antikoerper, PFN1 antikoerper, PFP antikoerper, PRF1 antikoerper, Pfn antikoerper, Pfp antikoerper, Prf-1 antikoerper, Cyta antikoerper, RATCYTA antikoerper, LOC443187 antikoerper, perforin antikoerper, prf1 antikoerper, cytolysin antikoerper, perforin-1 antikoerper, perforin-1-like antikoerper, perforin 1 antikoerper, perforin 1 (pore forming protein) antikoerper, perforin antikoerper, perforin 1 L homeolog antikoerper, PRF1 antikoerper, Prf1 antikoerper, LOC443187 antikoerper, prf1 antikoerper, prf1.L antikoerper

Hintergrund: PRF1 has structural and functional similarities to complement component 9 (C9). Like C9, this protein creates transmembrane tubules and is capable of lysing non-specifically a variety of target cells. This protein is one of the main cytolytic proteins of cytolytic granules, and it is known to be a key effector molecule for T-cell- and natural killer-cell-mediated cytolysis. Defects in the gene encoding PRF1 cause familial hemophagocytic lymphohistiocytosis type 2 (HPLH2), a rare and lethal autosomal recessive disorder of early childhood.

Molekulargewicht: 59 kDa (MW of target protein)

Pathways: Apoptose, Caspase Kaskade in der Apoptose