SOCS1 Antikörper (Middle Region)
-
- Target Alle SOCS1 Antikörper anzeigen
- SOCS1 (Suppressor of Cytokine Signaling 1 (SOCS1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SOCS1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SOCS1 antibody was raised against the middle region of SOCS1
- Aufreinigung
- Affinity purified
- Immunogen
- SOCS1 antibody was raised using the middle region of SOCS1 corresponding to a region with amino acids RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA
- Top Product
- Discover our top product SOCS1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SOCS1 Blocking Peptide, catalog no. 33R-8127, is also available for use as a blocking control in assays to test for specificity of this SOCS1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SOCS1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SOCS1 (Suppressor of Cytokine Signaling 1 (SOCS1))
- Andere Bezeichnung
- SOCS1 (SOCS1 Produkte)
- Hintergrund
- SOCS1 is a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. SOCS1 functions downstream of cytokine receptors, and takes part in a negative feedback loop to attenuate cytokine signaling. Knockout studies in mice suggested the role of its gene as a modulator of IFN-gamma action, which is required for normal postnatal growth and survival.
- Molekulargewicht
- 23 kDa (MW of target protein)
- Pathways
- JAK-STAT Signalweg, Interferon-gamma Pathway, TLR Signalweg, Response to Growth Hormone Stimulus
-