DIRAS1 Antikörper (Middle Region)
-
- Target Alle DIRAS1 Antikörper anzeigen
- DIRAS1 (DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DIRAS1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DIRAS1 antibody was raised against the middle region of DIRAS1
- Aufreinigung
- Affinity purified
- Immunogen
- DIRAS1 antibody was raised using the middle region of DIRAS1 corresponding to a region with amino acids KCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVK
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DIRAS1 Blocking Peptide, catalog no. 33R-4266, is also available for use as a blocking control in assays to test for specificity of this DIRAS1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DIRAS1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DIRAS1 (DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1))
- Andere Bezeichnung
- DIRAS1 (DIRAS1 Produkte)
- Synonyme
- Di-Ras1 antikoerper, GBTS1 antikoerper, RIG antikoerper, Gbts1 antikoerper, diras1 antikoerper, fi18d11 antikoerper, wu:fi18d11 antikoerper, zgc:55360 antikoerper, si:dkey-97k23.2 antikoerper, rig antikoerper, gbts1 antikoerper, di-ras1 antikoerper, MGC146486 antikoerper, DIRAS family GTPase 1 antikoerper, DIRAS family, GTP-binding RAS-like 1 antikoerper, DIRAS family, GTP-binding RAS-like 1a antikoerper, DIRAS family, GTP-binding RAS-like 1b antikoerper, DIRAS family GTP binding RAS like 1 antikoerper, DIRAS1 antikoerper, Diras1 antikoerper, diras1a antikoerper, diras1b antikoerper, diras1 antikoerper
- Hintergrund
- DIRAS1 belongs to a distinct branch of the functionally diverse Ras superfamily of monomeric GTPases.
- Molekulargewicht
- 22 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-