ACOT11 Antikörper (Middle Region)
-
- Target Alle ACOT11 Antikörper anzeigen
- ACOT11 (Acyl-CoA Thioesterase 11 (ACOT11))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACOT11 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ACOT11 antibody was raised against the middle region of ACOT11
- Aufreinigung
- Affinity purified
- Immunogen
- ACOT11 antibody was raised using the middle region of ACOT11 corresponding to a region with amino acids AEKTRVESVELVLPPHANHQGNTFGGQIMAWMENVATIAASRLCRAHPTL
- Top Product
- Discover our top product ACOT11 Primärantikörper
-
anti-Acyl-CoA Thioesterase 11 (ACOT11) (AA 549-575), (C-Term) antibody
ACOT11 Reaktivität: Human WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB21693 unconjugated
anti-Acyl-CoA Thioesterase 11 (ACOT11) antibodyACOT11 Reaktivität: Human, Maus ELISA, WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Acyl-CoA Thioesterase 11 (ACOT11) (AA 1-110) antibodyACOT11 Reaktivität: Human ELISA, WB Wirt: Maus Monoclonal 4D1 unconjugated
anti-Acyl-CoA Thioesterase 11 (ACOT11) antibodyACOT11 Reaktivität: Human, Maus ELISA, WB Wirt: Kaninchen Polyclonal unconjugated
anti-Acyl-CoA Thioesterase 11 (ACOT11) (Internal Region) antibodyACOT11 Reaktivität: Human, Maus, Ratte ELISA, WB Wirt: Kaninchen Polyclonal unconjugated
anti-Acyl-CoA Thioesterase 11 (ACOT11) (AA 504-553) antibodyACOT11 Reaktivität: Human, Ratte, Hund, Pferd, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Acyl-CoA Thioesterase 11 (ACOT11) (AA 215-264) antibodyACOT11 Reaktivität: Human, Maus, Ratte, Hund, Pferd, Rind (Kuh), Meerschweinchen, Kaninchen, Affe, Huhn, Xenopus laevis WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Acyl-CoA Thioesterase 11 (ACOT11) (AA 549-575) antibodyACOT11 Reaktivität: Human ELISA, WB, IHC, FACS Wirt: Kaninchen Polyclonal unconjugated
anti-Acyl-CoA Thioesterase 11 (ACOT11) (AA 19-250) antibodyACOT11 Reaktivität: Human WB, IHC (p), EIA Wirt: Maus Monoclonal J4B2 unconjugated
anti-Acyl-CoA Thioesterase 11 (ACOT11) (Middle Region) antibodyACOT11 Reaktivität: Human, Maus, Ratte, Hund, Pferd, Rind (Kuh), Meerschweinchen, Kaninchen, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACOT11 Blocking Peptide, catalog no. 33R-1133, is also available for use as a blocking control in assays to test for specificity of this ACOT11 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACOT11 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACOT11 (Acyl-CoA Thioesterase 11 (ACOT11))
- Andere Bezeichnung
- ACOT11 (ACOT11 Produkte)
- Synonyme
- BFIT antikoerper, STARD14 antikoerper, THEA antikoerper, THEM1 antikoerper, 1110020M10Rik antikoerper, 2010309H15Rik antikoerper, AW060409 antikoerper, BFIT1 antikoerper, Thea antikoerper, Them1 antikoerper, mKIAA0707 antikoerper, acot11 antikoerper, zgc:113011 antikoerper, ACOT11 antikoerper, DKFZp469E1816 antikoerper, acyl-CoA thioesterase 11 antikoerper, acyl-CoA thioesterase 11a antikoerper, acyl-CoA thioesterase 11 L homeolog antikoerper, ACOT11 antikoerper, Acot11 antikoerper, acot11a antikoerper, acot11.L antikoerper, acot11 antikoerper
- Hintergrund
- ACOT11 is a protein with acyl-CoA thioesterase activity towards medium (C12) and long-chain (C18) fatty acyl-CoA substrates. Expression of a similar murine protein in brown adipose tissue is induced by cold exposure and repressed by warmth.
- Molekulargewicht
- 65 kDa (MW of target protein)
-
