PKC gamma Antikörper (Middle Region)

Produktnummer ABIN634424

Produktdetails anti-PKC gamma Antikörper

Target: PKC gamma (PRKCG) (Protein Kinase C, gamma (PRKCG))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PKC gamma Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRKCG antibody was raised against the middle region of PRKCG

Aufreinigung: Affinity purified

Immunogen: PRKCG antibody was raised using the middle region of PRKCG corresponding to a region with amino acids WSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRKCG Blocking Peptide, catalog no. 33R-10011, is also available for use as a blocking control in assays to test for specificity of this PRKCG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKCG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PKC gamma

Target: PKC gamma (PRKCG) (Protein Kinase C, gamma (PRKCG))

Andere Bezeichnung: PRKCG (PRKCG Produkte)

Synonyme: PRKCG antikoerper, PKC-gamma antikoerper, PKCC antikoerper, PKCG antikoerper, SCA14 antikoerper, PKCgamma antikoerper, Pkcc antikoerper, Prkcc antikoerper, PKC antikoerper, PKCI antikoerper, Prkc antikoerper, RATPKCI antikoerper, protein kinase C gamma antikoerper, protein kinase C, gamma antikoerper, protein kinase C gamma type antikoerper, PRKCG antikoerper, Prkcg antikoerper, LOC484316 antikoerper

Hintergrund: Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets.

Molekulargewicht: 78 kDa (MW of target protein)

Pathways: WNT Signalweg, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction, G-protein mediated Events, Positive Regulation of Response to DNA Damage Stimulus, Interaction of EGFR with phospholipase C-gamma, Thromboxane A2 Receptor Signaling, VEGF Signaling