TRPC4AP Antikörper (Middle Region)
-
- Target Alle TRPC4AP Antikörper anzeigen
- TRPC4AP (Transient Receptor Potential Cation Channel, Subfamily C, Member 4 Associated Protein (TRPC4AP))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TRPC4AP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TRPC4 AP antibody was raised against the middle region of TRPC4 P
- Aufreinigung
- Affinity purified
- Immunogen
- TRPC4 AP antibody was raised using the middle region of TRPC4 P corresponding to a region with amino acids GASEENGLPHTSARTQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQVH
- Top Product
- Discover our top product TRPC4AP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TRPC4AP Blocking Peptide, catalog no. 33R-3171, is also available for use as a blocking control in assays to test for specificity of this TRPC4AP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPC0 P antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRPC4AP (Transient Receptor Potential Cation Channel, Subfamily C, Member 4 Associated Protein (TRPC4AP))
- Andere Bezeichnung
- TRPC4AP (TRPC4AP Produkte)
- Synonyme
- TRPC4AP antikoerper, MGC130977 antikoerper, 4833429F06Rik antikoerper, D2Ertd113e antikoerper, Trrp4ap antikoerper, mFLJ00177 antikoerper, truss antikoerper, C20orf188 antikoerper, TRRP4AP antikoerper, TRUSS antikoerper, transient receptor potential cation channel subfamily C member 4 associated protein antikoerper, transient receptor potential cation channel, subfamily C, member 4 associated protein L homeolog antikoerper, transient receptor potential cation channel, subfamily C, member 4 associated protein antikoerper, TRPC4AP antikoerper, trpc4ap.L antikoerper, trpc4ap antikoerper, Trpc4ap antikoerper
- Hintergrund
- TRPC4AP may participate in the activation of NFKB1 in response to ligation of TNFRSF1A. TRPC4AP could serve as a scaffolding protein to link TNFRSF1A to the IKK signalosome.
- Molekulargewicht
- 91 kDa (MW of target protein)
-