RGS11 Antikörper (Middle Region)

Produktnummer ABIN634383

Produktdetails anti-RGS11 Antikörper

Target: RGS11 (Regulator of G-Protein Signaling 11 (RGS11))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RGS11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RGS11 antibody was raised against the middle region of RGS11

Aufreinigung: Affinity purified

Immunogen: RGS11 antibody was raised using the middle region of RGS11 corresponding to a region with amino acids LRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKALLAEAGIPLEMKRR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RGS11 Blocking Peptide, catalog no. 33R-5382, is also available for use as a blocking control in assays to test for specificity of this RGS11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RGS11

Target: RGS11 (Regulator of G-Protein Signaling 11 (RGS11))

Andere Bezeichnung: RGS11 (RGS11 Produkte)

Synonyme: RS11 antikoerper, C78048 antikoerper, XRGSIV antikoerper, rgs9-a antikoerper, regulator of G protein signaling 11 antikoerper, regulator of G-protein signaling 11 antikoerper, regulator of G-protein signaling 11 L homeolog antikoerper, RGS11 antikoerper, Rgs11 antikoerper, rgs11.L antikoerper

Hintergrund: RGS11 belongs to the RGS (regulator of G protein signaling) family. Members of the RGS family act as GTPase-activating proteins on the alpha subunits of heterotrimeric, signal-transducing G proteins. This protein inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form.

Molekulargewicht: 51 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling