CD160 Antikörper (Middle Region)

Produktnummer ABIN634374

Produktdetails anti-CD160 Antikörper

Target: CD160

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CD160 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CD160 antibody was raised against the middle region of CD160

Aufreinigung: Affinity purified

Immunogen: CD160 antibody was raised using the middle region of CD160 corresponding to a region with amino acids SGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CD160 Blocking Peptide, catalog no. 33R-8498, is also available for use as a blocking control in assays to test for specificity of this CD160 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD160 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CD160

Target: CD160

Andere Bezeichnung: CD160 (CD160 Produkte)

Synonyme: CD160 antikoerper, RGD1563598 antikoerper, BY55 antikoerper, AU045688 antikoerper, By55 antikoerper, NK1 antikoerper, NK28 antikoerper, CD160 molecule antikoerper, CD160 antigen antikoerper, CD160 antikoerper, Cd160 antikoerper

Hintergrund: CD160 is an 27 kDa glycoprotein which was initially identified with the monoclonal antibody BY55. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity.

Molekulargewicht: 20 kDa (MW of target protein)