PTK6 Antikörper (Middle Region)

Produktnummer ABIN634359

Produktdetails anti-PTK6 Antikörper

Target: PTK6 (PTK6 Protein tyrosine Kinase 6 (PTK6))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTK6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PTK6 antibody was raised against the middle region of PTK6

Aufreinigung: Affinity purified

Immunogen: PTK6 antibody was raised using the middle region of PTK6 corresponding to a region with amino acids SELLDIAWQVAEGMCYLESQNYIHRDLAARNILVGENTLCKVGDFGLARL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PTK6 Blocking Peptide, catalog no. 33R-8390, is also available for use as a blocking control in assays to test for specificity of this PTK6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTK6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PTK6

Target: PTK6 (PTK6 Protein tyrosine Kinase 6 (PTK6))

Andere Bezeichnung: PTK6 (PTK6 Produkte)

Synonyme: BRK antikoerper, Sik antikoerper, Tksk antikoerper, tks antikoerper, zgc:153964 antikoerper, protein tyrosine kinase 6 antikoerper, PTK6 protein tyrosine kinase 6 antikoerper, PTK6 protein tyrosine kinase 6b antikoerper, PTK6 antikoerper, Ptk6 antikoerper, ptk6b antikoerper

Hintergrund: The protein encoded by this gene is a cytoplasmic nonreceptor protein kinase which may function as an intracellular signal transducer in epithelial tissues.

Molekulargewicht: 52 kDa (MW of target protein)