CAP1 Antikörper
-
- Target Alle CAP1 Antikörper anzeigen
- CAP1 (CAP, Adenylate Cyclase-Associated Protein 1 (CAP1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CAP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSL
- Top Product
- Discover our top product CAP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CAP1 Blocking Peptide, catalog no. 33R-5624, is also available for use as a blocking control in assays to test for specificity of this CAP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CAP1 (CAP, Adenylate Cyclase-Associated Protein 1 (CAP1))
- Andere Bezeichnung
- CAP1 (CAP1 Produkte)
- Synonyme
- CAP antikoerper, CAP1-PEN antikoerper, CAP1 antikoerper, DKFZp459E1319 antikoerper, cap1 antikoerper, Mch1 antikoerper, fj98f01 antikoerper, zgc:63872 antikoerper, wu:fj98f01 antikoerper, cyclase associated actin cytoskeleton regulatory protein 1 antikoerper, adenylyl cyclase-associated protein 1 antikoerper, Cap1 CAP, adenylate cyclase-associated protein 1 antikoerper, CAP, adenylate cyclase-associated protein 1 (yeast) antikoerper, adenylate cyclase associated protein 1 antikoerper, adenylyl cyclase-associated protein Cap1 antikoerper, CAP1 antikoerper, LOC5580331 antikoerper, cap1 antikoerper, Cap1 antikoerper
- Hintergrund
- The protein encoded by this gene is related to the S. cerevisiae CAP protein, which is involved in the cyclic AMP pathway. The human protein is able to interact with other molecules of the same protein, as well as with CAP2 and actin.
- Molekulargewicht
- 52 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process
-