CAP1 Antikörper

Produktnummer ABIN634355

Produktdetails anti-CAP1 Antikörper

Target: CAP1 (CAP, Adenylate Cyclase-Associated Protein 1 (CAP1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CAP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CAP1 Blocking Peptide, catalog no. 33R-5624, is also available for use as a blocking control in assays to test for specificity of this CAP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CAP1

Target: CAP1 (CAP, Adenylate Cyclase-Associated Protein 1 (CAP1))

Andere Bezeichnung: CAP1 (CAP1 Produkte)

Synonyme: CAP antikoerper, CAP1-PEN antikoerper, CAP1 antikoerper, DKFZp459E1319 antikoerper, cap1 antikoerper, Mch1 antikoerper, fj98f01 antikoerper, zgc:63872 antikoerper, wu:fj98f01 antikoerper, cyclase associated actin cytoskeleton regulatory protein 1 antikoerper, adenylyl cyclase-associated protein 1 antikoerper, Cap1 CAP, adenylate cyclase-associated protein 1 antikoerper, CAP, adenylate cyclase-associated protein 1 (yeast) antikoerper, adenylate cyclase associated protein 1 antikoerper, adenylyl cyclase-associated protein Cap1 antikoerper, CAP1 antikoerper, LOC5580331 antikoerper, cap1 antikoerper, Cap1 antikoerper

Hintergrund: The protein encoded by this gene is related to the S. cerevisiae CAP protein, which is involved in the cyclic AMP pathway. The human protein is able to interact with other molecules of the same protein, as well as with CAP2 and actin.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: cAMP Metabolic Process