DGKH Antikörper (Middle Region)

Produktnummer ABIN634354

Produktdetails anti-DGKH Antikörper

Target: DGKH (Diacylglycerol Kinase, eta (DGKH))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DGKH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DGKH antibody was raised against the middle region of DGKH

Aufreinigung: Affinity purified

Immunogen: DGKH antibody was raised using the middle region of DGKH corresponding to a region with amino acids DLDSVDGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DGKH Blocking Peptide, catalog no. 33R-2038, is also available for use as a blocking control in assays to test for specificity of this DGKH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGKH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DGKH

Target: DGKH (Diacylglycerol Kinase, eta (DGKH))

Andere Bezeichnung: DGKH (DGKH Produkte)

Hintergrund: DGKH is a member of the diacylglycerol kinase (DGK) enzyme family of proteins, specifically the type II DGK subfamily. Members of this family are involved in regulating the intracellular concentrations of diacylglycerol and phosphatidic acid.

Molekulargewicht: 135 kDa (MW of target protein)