RPS6KA2 Antikörper (Middle Region)

Produktnummer ABIN634332

Produktdetails anti-RPS6KA2 Antikörper

Target: RPS6KA2 (Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 2 (RPS6KA2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPS6KA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RPS6 KA2 antibody was raised against the middle region of RPS6 A2

Aufreinigung: Affinity purified

Immunogen: RPS6 KA2 antibody was raised using the middle region of RPS6 A2 corresponding to a region with amino acids LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPS6KA2 Blocking Peptide, catalog no. 33R-5450, is also available for use as a blocking control in assays to test for specificity of this RPS6KA2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS0 A2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPS6KA2

Target: RPS6KA2 (Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 2 (RPS6KA2))

Andere Bezeichnung: RPS6KA2 (RPS6KA2 Produkte)

Synonyme: HU-2 antikoerper, MAPKAPK1C antikoerper, RSK antikoerper, RSK3 antikoerper, S6K-alpha antikoerper, S6K-alpha2 antikoerper, p90-RSK3 antikoerper, pp90RSK3 antikoerper, 90kDa antikoerper, D17Wsu134e antikoerper, Rps6ka-rs1 antikoerper, Rsk3 antikoerper, p90rsk antikoerper, pp90rsk antikoerper, ribosomal protein S6 kinase A2 antikoerper, ribosomal protein S6 kinase, polypeptide 2 antikoerper, Rps6ka2 antikoerper, RPS6KA2 antikoerper

Hintergrund: RPS6KA2 is a serine/threonine kinase that may play a role in mediating the growth-factor and stress induced activation of the transcription factor CREB.

Molekulargewicht: 81 kDa (MW of target protein)

Pathways: MAPK Signalweg, Neurotrophin Signalübertragung, Regulation of Systemic Arterial Blood Pressure by Hormones, Activation of Innate immune Response, Toll-Like Receptors Cascades