C4BPA Antikörper (Middle Region)

Produktnummer ABIN634312

Produktdetails anti-C4BPA Antikörper

Target: C4BPA (Complement Component 4 Binding Protein, alpha (C4BPA))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C4BPA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C4 BPA antibody was raised against the middle region of C4 PA

Aufreinigung: Affinity purified

Immunogen: C4 BPA antibody was raised using the middle region of C4 PA corresponding to a region with amino acids QVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C4BPA Blocking Peptide, catalog no. 33R-7781, is also available for use as a blocking control in assays to test for specificity of this C4BPA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 PA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C4BPA

Target: C4BPA (Complement Component 4 Binding Protein, alpha (C4BPA))

Andere Bezeichnung: C4BPA (C4BPA Produkte)

Synonyme: CRES antikoerper, c4bp antikoerper, C4BP antikoerper, PRP antikoerper, complement component 4 binding protein, alpha chain antikoerper, C4b-binding protein alpha chain antikoerper, complement component 4 binding protein alpha antikoerper, complement component 4 binding protein, alpha antikoerper, LOC419851 antikoerper, c4bp antikoerper, C4BPA antikoerper, C4bpa antikoerper

Hintergrund: C4BPA is a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identical alpha-chains encoded by this gene assemble into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster.

Molekulargewicht: 62 kDa (MW of target protein)

Pathways: Komplementsystem