SLC12A4 Antikörper

Produktnummer ABIN634278

Produktdetails anti-SLC12A4 Antikörper

Target: SLC12A4 (Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 4 (SLC12A4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC12A4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC12 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC12A4 Blocking Peptide, catalog no. 33R-6285, is also available for use as a blocking control in assays to test for specificity of this SLC12A4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC12A4

Target: SLC12A4 (Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 4 (SLC12A4))

Andere Bezeichnung: SLC12A4 (SLC12A4 Produkte)

Synonyme: KCC1 antikoerper, kcc1 antikoerper, SLC12A4 antikoerper, AW546649 antikoerper, RBCKCC1 antikoerper, Kcc1 antikoerper, solute carrier family 12 member 4 antikoerper, solute carrier family 12 (potassium/chloride transporter), member 4 L homeolog antikoerper, solute carrier family 12, member 4 antikoerper, SLC12A4 antikoerper, slc12a4.L antikoerper, Slc12a4 antikoerper

Hintergrund: SLC12A4 mediates electroneutral potassium-chloride cotransport when activated by cell swelling. SLC12A4 may contribute to cell volume homeostasis in single cells.

Molekulargewicht: 121 kDa (MW of target protein)