APBB2 Antikörper (Middle Region)
-
- Target Alle APBB2 Antikörper anzeigen
- APBB2 (Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 2 (APBB2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser APBB2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- APBB2 antibody was raised against the middle region of APBB2
- Aufreinigung
- Affinity purified
- Immunogen
- APBB2 antibody was raised using the middle region of APBB2 corresponding to a region with amino acids QNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHSFQTDPDLPPGWKRVS
- Top Product
- Discover our top product APBB2 Primärantikörper
-
anti-Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 2 (APBB2) (Internal Region) antibody
APBB2 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC, ICC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 2 (APBB2) (AA 1-100) antibodyAPBB2 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 2D8 unconjugated
anti-Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 2 (APBB2) (AA 216-244) antibodyAPBB2 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB42741 unconjugated
anti-Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 2 (APBB2) (AA 1-329) antibodyAPBB2 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 2 (APBB2) (AA 63-112) antibodyAPBB2 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Meerschweinchen, Hund, Pferd, Kaninchen, Affe, Fledermaus, Huhn, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 2 (APBB2) (AA 251-300) antibodyAPBB2 Reaktivität: Human, Maus, Ratte, Meerschweinchen, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 2 (APBB2) antibodyAPBB2 Reaktivität: Human, Maus, Ratte, Rind (Kuh) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 2 (APBB2) (AA 471-520) antibodyAPBB2 Reaktivität: Human, Maus WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 2 (APBB2) (Middle Region) antibodyAPBB2 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Meerschweinchen, Hund, Pferd, Kaninchen, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
APBB2 Blocking Peptide, catalog no. 33R-7664, is also available for use as a blocking control in assays to test for specificity of this APBB2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APBB2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APBB2 (Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 2 (APBB2))
- Andere Bezeichnung
- APBB2 (APBB2 Produkte)
- Synonyme
- FE65L antikoerper, FE65L1 antikoerper, 2310007D03Rik antikoerper, Rirl1 antikoerper, TR2L antikoerper, Zfra antikoerper, RGD1562438 antikoerper, APBB2 antikoerper, fe65l antikoerper, fe65l1 antikoerper, DKFZp469I236 antikoerper, si:ch211-201g8.2 antikoerper, amyloid beta precursor protein binding family B member 2 antikoerper, amyloid beta (A4) precursor protein-binding, family B, member 2 antikoerper, amyloid beta (A4) precursor protein-binding, family B, member 2b antikoerper, APBB2 antikoerper, Apbb2 antikoerper, apbb2 antikoerper, apbb2b antikoerper
- Hintergrund
- APBB2 may modulate the internalization of beta-amyloid precursor protein.
- Molekulargewicht
- 81 kDa (MW of target protein)
-
