TPTE Antikörper (Middle Region)
-
- Target Alle TPTE Antikörper anzeigen
- TPTE (Transmembrane Phosphatase with Tensin Homology (TPTE))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TPTE Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TPTE antibody was raised against the middle region of TPTE
- Aufreinigung
- Affinity purified
- Immunogen
- TPTE antibody was raised using the middle region of TPTE corresponding to a region with amino acids YFAQVKHLYNWNLPPRRILFIKHFIIYSIPRYVRDLKIQIEMEKKVVFST
- Top Product
- Discover our top product TPTE Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TPTE Blocking Peptide, catalog no. 33R-10091, is also available for use as a blocking control in assays to test for specificity of this TPTE antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPTE antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TPTE (Transmembrane Phosphatase with Tensin Homology (TPTE))
- Andere Bezeichnung
- TPTE (TPTE Produkte)
- Synonyme
- CT44 antikoerper, PTEN2 antikoerper, Pten2 antikoerper, tpip antikoerper, vsp antikoerper, wu:fd20e11 antikoerper, wu:fi24b06 antikoerper, transmembrane phosphatase with tensin homology antikoerper, TPTE antikoerper, Tpte antikoerper, tpte antikoerper
- Hintergrund
- TPTE encodes a putative transmembrane tyrosine phosphatase that may be involved in signal transduction pathways of the endocrine or spermatogenetic function of the testis.
- Molekulargewicht
- 64 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-