LIG1 Antikörper (Middle Region)

Produktnummer ABIN634194

Produktdetails anti-LIG1 Antikörper

Target: LIG1 (Ligase I, DNA, ATP-Dependent (LIG1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LIG1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LIG1 antibody was raised against the middle region of LIG1

Aufreinigung: Affinity purified

Immunogen: LIG1 antibody was raised using the middle region of LIG1 corresponding to a region with amino acids ALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LIG1 Blocking Peptide, catalog no. 33R-1328, is also available for use as a blocking control in assays to test for specificity of this LIG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LIG1

Target: LIG1 (Ligase I, DNA, ATP-Dependent (LIG1))

Andere Bezeichnung: LIG1 (LIG1 Produkte)

Synonyme: ATLIG1 antikoerper, DNA ligase 1 antikoerper, T6D22.23 antikoerper, ligI antikoerper, AL033288 antikoerper, LigI antikoerper, lig1 antikoerper, wu:fc54a11 antikoerper, DNA ligase 1 antikoerper, DNA ligase 1, putative antikoerper, ligase I, DNA, ATP-dependent L homeolog antikoerper, ligase I, DNA, ATP-dependent antikoerper, LIG1 antikoerper, PB000674.02.0 antikoerper, PTRG_06243 antikoerper, PKH_140260 antikoerper, lig1.L antikoerper, Lig1 antikoerper, lig-1 antikoerper, lig1 antikoerper

Hintergrund: LIG1 encodes DNA ligase I, with functions in DNA replication and the base excision repair process. Mutations in LIG1 that lead to DNA ligase I deficiency result in immunodeficiency and increased sensitivity to DNA-damaging agents.

Molekulargewicht: 102 kDa (MW of target protein)

Pathways: Telomere Maintenance, DNA Reparatur, DNA Replication, Synthesis of DNA