LIG1 Antikörper (Middle Region)
-
- Target Alle LIG1 Antikörper anzeigen
- LIG1 (Ligase I, DNA, ATP-Dependent (LIG1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LIG1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LIG1 antibody was raised against the middle region of LIG1
- Aufreinigung
- Affinity purified
- Immunogen
- LIG1 antibody was raised using the middle region of LIG1 corresponding to a region with amino acids ALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDR
- Top Product
- Discover our top product LIG1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LIG1 Blocking Peptide, catalog no. 33R-1328, is also available for use as a blocking control in assays to test for specificity of this LIG1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIG1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LIG1 (Ligase I, DNA, ATP-Dependent (LIG1))
- Andere Bezeichnung
- LIG1 (LIG1 Produkte)
- Synonyme
- ATLIG1 antikoerper, DNA ligase 1 antikoerper, T6D22.23 antikoerper, ligI antikoerper, AL033288 antikoerper, LigI antikoerper, lig1 antikoerper, wu:fc54a11 antikoerper, DNA ligase 1 antikoerper, DNA ligase 1, putative antikoerper, ligase I, DNA, ATP-dependent L homeolog antikoerper, ligase I, DNA, ATP-dependent antikoerper, LIG1 antikoerper, PB000674.02.0 antikoerper, PTRG_06243 antikoerper, PKH_140260 antikoerper, lig1.L antikoerper, Lig1 antikoerper, lig-1 antikoerper, lig1 antikoerper
- Hintergrund
- LIG1 encodes DNA ligase I, with functions in DNA replication and the base excision repair process. Mutations in LIG1 that lead to DNA ligase I deficiency result in immunodeficiency and increased sensitivity to DNA-damaging agents.
- Molekulargewicht
- 102 kDa (MW of target protein)
- Pathways
- Telomere Maintenance, DNA Reparatur, DNA Replication, Synthesis of DNA
-