KIF2C Antikörper (N-Term)
-
- Target Alle KIF2C Antikörper anzeigen
- KIF2C (Kinesin Family Member 2C (KIF2C))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KIF2C Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KIF2 C antibody was raised against the N terminal of KIF2
- Aufreinigung
- Affinity purified
- Immunogen
- KIF2 C antibody was raised using the N terminal of KIF2 corresponding to a region with amino acids LHPKDNLPLQENVTIQKQKRRSVNSKIPAPKESLRSRSTRMSTVSELRIT
- Top Product
- Discover our top product KIF2C Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KIF2C Blocking Peptide, catalog no. 33R-5021, is also available for use as a blocking control in assays to test for specificity of this KIF2C antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIF2C (Kinesin Family Member 2C (KIF2C))
- Andere Bezeichnung
- KIF2C (KIF2C Produkte)
- Synonyme
- kif2c antikoerper, MGC89391 antikoerper, KIF2C antikoerper, si:ch211-61f14.1 antikoerper, KNSL6 antikoerper, MCAK antikoerper, 4930402F02Rik antikoerper, ESTM5 antikoerper, Knsl6 antikoerper, X83316 antikoerper, KRP2 antikoerper, kcm1 antikoerper, mcak antikoerper, kinesin family member 2C antikoerper, kinesin family member 2C S homeolog antikoerper, KIF2C antikoerper, kif2c antikoerper, Kif2c antikoerper, kif2c.S antikoerper
- Hintergrund
- KIF2C is a member of kinesin-like protein family. Proteins of this family are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. It is important for anaphase chromosome segregation and may be required to coordinate the onset of sister centromere separation.
- Molekulargewicht
- 81 kDa (MW of target protein)
- Pathways
- Microtubule Dynamics
-