ORC4 Antikörper

Produktnummer ABIN634162

Produktdetails anti-ORC4 Antikörper

Target: ORC4 (Origin Recognition Complex, Subunit 4 (ORC4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ORC4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ORC4 L antibody was raised using a synthetic peptide corresponding to a region with amino acids VLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ORC4L Blocking Peptide, catalog no. 33R-9651, is also available for use as a blocking control in assays to test for specificity of this ORC4L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ORC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ORC4

Target: ORC4 (Origin Recognition Complex, Subunit 4 (ORC4))

Andere Bezeichnung: ORC4L (ORC4 Produkte)

Synonyme: ORC4L antikoerper, ORC4P antikoerper, Orc4P antikoerper, Orc4l antikoerper, mMmORC4 antikoerper, CG2917 antikoerper, DmORC4 antikoerper, Dmel\\CG2917 antikoerper, ORC antikoerper, ORC4 antikoerper, dmOrc4 antikoerper, orc4 antikoerper, rDmORC antikoerper, orc4l antikoerper, fc50c03 antikoerper, wu:fc50c03 antikoerper, zgc:85772 antikoerper, ATORC4 antikoerper, F23H14.9 antikoerper, F23H14_9 antikoerper, ORIGIN RECOGNITION COMPLEX SUBUNIT 4 antikoerper, origin recognition complex subunit 4 antikoerper, origin recognition complex subunit 4 antikoerper, origin recognition complex, subunit 4 antikoerper, Origin recognition complex subunit 4 antikoerper, origin recognition complex subunit 4 L homeolog antikoerper, origin recognition complex subunit Orc4 antikoerper, ORC4 antikoerper, Orc4 antikoerper, orc4.L antikoerper, orc4 antikoerper, CNM01830 antikoerper

Hintergrund: The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells.

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA