CDC23 Antikörper
-
- Target Alle CDC23 Antikörper anzeigen
- CDC23 (Cell Division Cycle 23 (CDC23))
-
Reaktivität
- Human, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CDC23 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CDC23 antibody was raised using a synthetic peptide corresponding to a region with amino acids DTREEGKALLRQILQLRNQGETPTTEVPAPFFLPASLSANNTPTRRVSPL
- Top Product
- Discover our top product CDC23 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CDC23 Blocking Peptide, catalog no. 33R-2207, is also available for use as a blocking control in assays to test for specificity of this CDC23 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC23 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CDC23 (Cell Division Cycle 23 (CDC23))
- Andere Bezeichnung
- CDC23 (CDC23 Produkte)
- Synonyme
- CDC23 antikoerper, anaphase-promoting complex subunit 8 antikoerper, zgc:56013 antikoerper, 6030435O18 antikoerper, D18Ertd243e antikoerper, ANAPC8 antikoerper, APC8 antikoerper, CUT23 antikoerper, cell division cycle 23 antikoerper, cell division cycle protein 23 homolog antikoerper, anaphase-promoting complex subunit 8 antikoerper, CDC23 (cell division cycle 23, yeast, homolog) antikoerper, cell division cycle 23 S homeolog antikoerper, CDC23 cell division cycle 23 antikoerper, CDC23 antikoerper, LOC100162672 antikoerper, LOC100380698 antikoerper, APC8 antikoerper, cdc23 antikoerper, cdc23.S antikoerper, Cdc23 antikoerper
- Hintergrund
- CDC23 shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eukaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins.
- Molekulargewicht
- 65 kDa (MW of target protein)
- Pathways
- Protein targeting to Nucleus
-